DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and HB22

DIOPT Version :10

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_850266.1 Gene:HB22 / 818233 AraportID:AT2G36610 Length:185 Species:Arabidopsis thaliana


Alignment Length:182 Identity:41/182 - (22%)
Similarity:68/182 - (37%) Gaps:70/182 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YMDGGNTAASVTPGINIPGKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQDSG-----FPSPRSA 71
            ::||.::::.::|..|                        :.||  .|.||:.     ..:.:..
plant     8 FIDGASSSSFISPFYN------------------------FDHF--SGNQDNRCLGTMMGAQQDI 46

  Fly    72 LGYPFPPMHQNSYSGYHLGSYAPPCASPPKDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSLQL 136
            |..|...:.    |||.                      |:|. ..||:.||.:|    .:|.||
plant    47 LHVPLAMVE----SGYG----------------------EESN-SFNGQEKKKKK----MTSEQL 80

  Fly   137 QQLNRRFQ--------RTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYK 180
            :.|.|.||        |...|....:.:|:..|||...|:.:|||||::::|
plant    81 KFLERSFQEEIKLNPDRKMKLNPDRKMKLSKELGLQPRQIAVWFQNRKARWK 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeodomain 125..181 CDD:459649 21/64 (33%)
HB22NP_850266.1 Homeodomain 70..133 CDD:459649 23/67 (34%)
HALZ 134..167 CDD:460477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.