DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and cdx4

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_571184.2 Gene:cdx4 / 798281 ZFINID:ZDB-GENE-980526-330 Length:270 Species:Danio rerio


Alignment Length:232 Identity:65/232 - (28%)
Similarity:103/232 - (44%) Gaps:51/232 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GINIPGKSAFVELQQHA-AAGYGGIRSTYQHFGPQGGQDSGFPSPRS-----ALGYP---FPPMH 80
            ||::|.:: ||...|:: ..||..:.:...|....|...:.:.:||.     :||.|   ..||.
Zfish    23 GISLPPQN-FVSTPQYSDFTGYHHVPNMETHAQSAGAWGAPYGAPREDWGAYSLGPPNSISAPMS 86

  Fly    81 QNS----------YSGYH-LGSYAPPCASPPKDDFSISDKCEDSGLR-------------VNGKG 121
            .:|          |:..| .||...|   ||.::..::....:...|             ..||.
Zfish    87 NSSPGPVSYCSPDYNTMHGPGSAVLP---PPPENIPVAQLSPERERRNSYQWMSKTVQSSSTGKT 148

  Fly   122 KKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAA 186
            :...|.|.:|:..|..:|.:.|...:|:.:..::|||.:|||::.||||||||||:|.:|::|..
Zfish   149 RTKEKYRVVYTDHQRLELEKEFHFNRYITIRRKSELAVNLGLSERQVKIWFQNRRAKERKLIKKK 213

  Fly   187 QGPGTNSG----------MPLGGGGPNPGQHSPNQMH 213
            .|....||          .||    |.||..||:.:|
Zfish   214 LGQSDGSGGSVHSDPGSVSPL----PVPGSLSPSDIH 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 23/52 (44%)
cdx4NP_571184.2 Caudal_act 15..138 CDD:282574 26/118 (22%)
Homeobox 155..207 CDD:278475 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.