powered by:
Protein Alignment Dll and Obox1
DIOPT Version :9
Sequence 1: | NP_001137759.1 |
Gene: | Dll / 37973 |
FlyBaseID: | FBgn0000157 |
Length: | 347 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_082078.1 |
Gene: | Obox1 / 71468 |
MGIID: | 1918718 |
Length: | 204 |
Species: | Mus musculus |
Alignment Length: | 61 |
Identity: | 26/61 - (42%) |
Similarity: | 40/61 - (65%) |
Gaps: | 0/61 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 122 KKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKM 182
:|.||.||:|:..|...|.:.|...||....:..|||.|:|:|:.::||||:|.|:||::|
Mouse 92 RKFRKERTVYTKEQQGLLQKHFDECQYPNKKKIVELALSVGVTKREIKIWFKNNRAKYRRM 152
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0850 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR24327 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.