DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and Nkx6-3

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001102925.1 Gene:Nkx6-3 / 685102 RGDID:1597780 Length:262 Species:Rattus norvegicus


Alignment Length:176 Identity:58/176 - (32%)
Similarity:90/176 - (51%) Gaps:28/176 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 AGYGGIRSTYQHFGPQGGQDSGFPSPRSALGYPFPPMHQNSY--SGYHLGSYAPPCASPPKDDFS 105
            ||:||:.|...::|||.|.       .|..|..:|...:|.:  :|........||::.|.   .
  Rat    78 AGFGGLSSQGVYYGPQVGS-------FSKTGNEYPTRTRNCWADTGQDWRGSTRPCSNTPD---P 132

  Fly   106 ISDKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKI 170
            :||...           |.:..|..::..|:..|.:.|::|:|||.||||.||.|||:|::|||:
  Rat   133 LSDTIH-----------KKKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKV 186

  Fly   171 WFQNRRSKYKKMMKAAQGPGTNSGMPLGGGGPNPGQHSPNQMHSGE 216
            ||||||:|::|  |:|..|  :|..|...||.: |..:.::....|
  Rat   187 WFQNRRTKWRK--KSALEP--SSSTPRAPGGAS-GDRAASENEDDE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 28/52 (54%)
Nkx6-3NP_001102925.1 Homeobox 143..197 CDD:395001 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.