DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and Cdx2

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_076453.1 Gene:Cdx2 / 66019 RGDID:621234 Length:310 Species:Rattus norvegicus


Alignment Length:261 Identity:75/261 - (28%)
Similarity:109/261 - (41%) Gaps:76/261 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PKYMD--GGNTAASVTPGINI-----PGKSAFVELQQHAAAGYGG-IRSTYQHFGPQG------- 59
            |:|.|  |.:.||:.....|:     ||.|        ....||. :|..:..:.|.|       
  Rat    35 PQYPDYGGYHVAAAAAAAANLDSAQSPGPS--------WPTAYGAPLREDWNGYAPGGAAAANAV 91

  Fly    60 --GQDSGFPSPRSALGYPFPP---MHQNSYSGYHLGSYAPPCAS----------PPKDDFSISDK 109
              |.:.|  ||.:|:||..|.   .|.:.:...|..:.||.|||          |.....:.:::
  Rat    92 AHGLNGG--SPAAAMGYSSPAEYHAHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQ 154

  Fly   110 CEDSGLRVNGKGKKMRKP-----------------RTIYSSLQLQQLNRRFQRTQYLALPERAEL 157
            ...||.|.| ..:.||||                 |.:|:..|..:|.:.|..::|:.:..:|||
  Rat   155 LSPSGQRRN-LCEWMRKPAQPSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAEL 218

  Fly   158 AASLGLTQTQVKIWFQNRRSKYKKMMK------AAQGPGTNSGMPLGGGGPNPGQHSPNQMHSGE 216
            ||:|||::.||||||||||:|.:|:.|      ..|.|            |.|....|:|..||.
  Rat   219 AATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQP------------PAPPPPQPSQPQSGA 271

  Fly   217 L 217
            |
  Rat   272 L 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 26/69 (38%)
Cdx2NP_076453.1 Caudal_act 13..170 CDD:282574 36/145 (25%)
Homeobox 189..241 CDD:278475 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.