DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and Nkx6-1

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_113925.1 Gene:Nkx6-1 / 65193 RGDID:69318 Length:365 Species:Rattus norvegicus


Alignment Length:199 Identity:57/199 - (28%)
Similarity:89/199 - (44%) Gaps:23/199 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DAPDAPHTPKYMDGGNTAASVTPGINIPGKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQDSGFP 66
            |....|..|  :..|....|.:|..:....|:.......:||......:.........|..:|.|
  Rat   100 DILSRPSMP--VASGAALPSASPSGSSSSSSSSASATSASAAAAAAAAAAAAAASSPAGLLAGLP 162

  Fly    67 SPRSALGYPFPP----MHQNSYSGYHLGSYAPPCA---------------SPPKDDFSISDKCED 112
            . .|:|..|.||    ...::.:...:|.|..|.|               |||..|..::.....
  Rat   163 R-FSSLSPPPPPPGLYFSPSAAAVAAVGRYPKPLAELPGRTPIFWPGVMQSPPWRDARLACTPHQ 226

  Fly   113 SGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRS 177
            ..:.::..||: :..|..:|..|:..|.:.|::|:|||.||||.||.|||:|::|||:||||||:
  Rat   227 GSILLDKDGKR-KHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRT 290

  Fly   178 KYKK 181
            |::|
  Rat   291 KWRK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 29/52 (56%)
Nkx6-1NP_113925.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..136 7/37 (19%)
Repressor domain. /evidence=ECO:0000250 102..269 38/170 (22%)
Homeobox 240..294 CDD:395001 29/53 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 295..365 57/199 (29%)
Involved in DNA-binding. /evidence=ECO:0000250 307..365
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.