DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and vent

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_571775.1 Gene:vent / 64810 ZFINID:ZDB-GENE-010108-2 Length:170 Species:Danio rerio


Alignment Length:97 Identity:33/97 - (34%)
Similarity:50/97 - (51%) Gaps:11/97 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 APPCASPPKDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAEL 157
            |.|..|....|....|...::|        :.|:.||.::..|:..|.:.|.:.:||...:|.::
Zfish    41 ASPANSCGYTDVESDDSEVEAG--------QNRRVRTKFTCDQISGLEKSFSKHRYLGATQRRKI 97

  Fly   158 AASLGLTQTQVKIWFQNRRSKYKKM---MKAA 186
            |..|.|::||||.||||||.|.|:.   |:||
Zfish    98 AEKLHLSETQVKTWFQNRRMKLKREVQDMRAA 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 22/52 (42%)
ventNP_571775.1 Homeobox 68..120 CDD:278475 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588198
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.