DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and vox

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_571773.1 Gene:vox / 64807 ZFINID:ZDB-GENE-010108-1 Length:242 Species:Danio rerio


Alignment Length:266 Identity:61/266 - (22%)
Similarity:85/266 - (31%) Gaps:117/266 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 SPRSALGYPFPPMHQNS--YSGYHLGSYAPPCASPPKDDFSISD--KCEDSGLRVNGKGKKMRKP 127
            :||:...   |...:||  .|||...:.|..||       |:.|  ..|..|        ..|:.
Zfish    74 TPRNCSS---PSFSENSGYSSGYESEAAASECA-------SVEDGHDAEKDG--------ATRRI 120

  Fly   128 RTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTN 192
            ||.::..|:.:|.:.|.:.:||...||.:.|..|||::||::.||||||.|.|:.::        
Zfish   121 RTKFTPEQIDKLEKIFNKHKYLDAGERVKTALKLGLSETQIRTWFQNRRMKLKREVQ-------- 177

  Fly   193 SGMPLGGGGPNPGQHSPNQMHSGELANGRFLWAALETNGTLALVHSTGGNNGGGSNSGSPSHYLP 257
                              :|.:..|.                                 |...||
Zfish   178 ------------------EMRADFLL---------------------------------PQMVLP 191

  Fly   258 PGHSPTPSSTPVS------ELSPEFPPTGLSPPTQAPWDQKPHWIDHKPPPQMTPQPPHPAATLH 316
            |       ..||.      :..| |||                   |.|..|....|.||.   |
Zfish   192 P-------VIPVQYQCYDRQRLP-FPP-------------------HGPLVQQMMMPLHPH---H 226

  Fly   317 PQTHHH 322
            |...||
Zfish   227 PHPQHH 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 22/52 (42%)
voxNP_571773.1 COG5576 75..>187 CDD:227863 41/188 (22%)
Homeobox 121..173 CDD:278475 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588194
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.