DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and Vax1

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_072158.1 Gene:Vax1 / 64571 RGDID:621132 Length:336 Species:Rattus norvegicus


Alignment Length:268 Identity:64/268 - (23%)
Similarity:90/268 - (33%) Gaps:106/268 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 GSYAPPCASPPKDDFSISDKCED------------------------SGLR--VNGKGKKMRKP- 127
            ||........|:..||.|...||                        ..:|  :..||..:.:| 
  Rat    37 GSLPAAFLKEPQGAFSASGASEDCNKSKSNSSADPDYCRRILVRDAKGSIREIILPKGLDLDRPK 101

  Fly   128 --RTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKK--------- 181
              ||.:::.||.:|...|||.||:...||.|||..|.|::||||:||||||:|.||         
  Rat   102 RTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQGKDSELR 166

  Fly   182 --------------------------------------MMKAAQGP-------GTNSGM------ 195
                                                  :..|.:||       |..:|.      
  Rat   167 SVVSETAATCSVLRLLEQGRLLSPPGLPALLPPCATGALGSALRGPSLPALGAGAAAGSAAAAAA 231

  Fly   196 ---------------PLGGGGPNPGQHSPNQMHSG--ELANGRFLWAALETNGTLALVHSTGGNN 243
                           |..||.|.||...|..:|:|  ..::|.|........|::|...|:....
  Rat   232 AATAPGPAGAASQHPPAVGGAPGPGPAGPGGLHAGAPTASHGLFSLPVPSLLGSVASRLSSAPLT 296

  Fly   244 GGGSNSGS 251
            ..||.:|:
  Rat   297 MAGSLAGN 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 29/55 (53%)
Vax1NP_072158.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..69 5/18 (28%)
vax upstream domain 72..99 3/26 (12%)
homeobox 100..159 31/58 (53%)
Homeobox 103..156 CDD:278475 28/52 (54%)
vax downstream domain 178..189 0/10 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..267 8/30 (27%)
vax terminal domain 315..323
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.