DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and lbx2

DIOPT Version :10

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001007135.1 Gene:lbx2 / 64276 ZFINID:ZDB-GENE-001206-2 Length:257 Species:Danio rerio


Alignment Length:141 Identity:46/141 - (32%)
Similarity:68/141 - (48%) Gaps:22/141 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PSPRSALGYPFPPM-------HQNSYSGYHLGSYAPPC-----ASPPKDDFSIS-DKCEDSGLRV 117
            ||.:.::|...||.       ...|.:|....| :|.|     ||.......:| .:..:....:
Zfish    51 PSVKKSVGSLCPPRVLEKVTGSSASRNGISAPS-SPLCALEELASKTFKGLEVSVIQAAEGREHI 114

  Fly   118 NGKG-----KKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRS 177
            |..|     ||.||.||.:::.|:.:|.:||...:||:..:|.::|..||||..||..||||||:
Zfish   115 NAFGQRQASKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRA 179

  Fly   178 KYKK---MMKA 185
            |.|:   .|||
Zfish   180 KLKRDLEEMKA 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeodomain 125..181 CDD:459649 25/55 (45%)
lbx2NP_001007135.1 Required for convergent extension movement and hypaxial myogenesis during gastrulation. Required for the formation of thick and thin myofilaments. Required for myod1 expression in the pectoral fin bud. Required for continuous expression of cxcl12a in the posterior lateral mesoderm at the tail bud stage and in adaxial cells at the 10-somite stage. /evidence=ECO:0000269|PubMed:19216761, ECO:0000269|PubMed:22216300, ECO:0000269|PubMed:22406073 1..46
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
Homeodomain 127..183 CDD:459649 25/55 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..257
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.