DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and hoxc1a

DIOPT Version :10

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_571606.1 Gene:hoxc1a / 58046 ZFINID:ZDB-GENE-000822-2 Length:302 Species:Danio rerio


Alignment Length:88 Identity:37/88 - (42%)
Similarity:51/88 - (57%) Gaps:9/88 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 KCEDSGLRVNGKGKKMRK------PRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQ 167
            ||.|..|:.| .|:...:      .||.:::.||.:|.:.|...:||....|.|:|..|.|::||
Zfish   195 KCSDRELKTN-HGRDSDEDTSSGGSRTNFTTKQLTELEKEFHFNKYLTRARRIEIANPLQLSETQ 258

  Fly   168 VKIWFQNRRSKYKKMMK--AAQG 188
            |||||||||.|.|||::  .|||
Zfish   259 VKIWFQNRRMKQKKMLREGLAQG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeodomain 125..181 CDD:459649 25/61 (41%)
hoxc1aNP_571606.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..224 6/26 (23%)
Homeodomain 218..272 CDD:459649 25/53 (47%)

Return to query results.
Submit another query.