DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and dlx5

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001004778.1 Gene:dlx5 / 447997 XenbaseID:XB-GENE-853057 Length:289 Species:Xenopus tropicalis


Alignment Length:357 Identity:117/357 - (32%)
Similarity:141/357 - (39%) Gaps:132/357 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DAPDAPHTPK----YMDGGNTAASVTPGINIPGKSAFVELQQHAAAGYGGIRSTYQH-FGPQGGQ 61
            |:|..|.:..    |...|..|.....|...|           .:|.||...:.||: :....|.
 Frog    27 DSPTLPESTATDSGYYSPGGAAGHPHHGYCSP-----------TSATYGKALNAYQYQYHGMNGA 80

  Fly    62 DSGFPSPR-SALGY--PFPPMHQNSYSGYHLGSYAPPCASPPKDDFSISDKCEDSGLRVNGKGKK 123
            ...:|... |..||  |:.|.||  |||.: ....||.:.|.|:   :|   |.....||||.||
 Frog    81 AGNYPGKAYSDYGYGSPYHPHHQ--YSGAY-NRVQPPSSQPEKE---VS---EPEVRMVNGKPKK 136

  Fly   124 MRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQG 188
            :|||||||||.||..|.||||:|||||||||||||||||||||||||||||:|||.||:||    
 Frog   137 IRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMK---- 197

  Fly   189 PGTNSGMPLGGGGPNPGQHSPNQMHSGELANGRFLWAALETNGTLALVHSTGGNNGGGSNSGSPS 253
                                          ||.                                
 Frog   198 ------------------------------NGE-------------------------------- 200

  Fly   254 HYLPPGHSPTPSSTPVSELSPEFPPTGLSPPTQAPWDQKPHWIDHKPPPQMTPQPPHPAATLHPQ 318
              |||.|||: ||.|::..||:.|         ..|:               ||....:.:.||.
 Frog   201 --LPPEHSPS-SSDPMACNSPQSP---------VVWE---------------PQGSSRSLSHHPH 238

  Fly   319 THHHNPPPQMGGYVP--------QYWYQPETN 342
            .|.|   ||..|..|        ..||...|:
 Frog   239 VHSH---PQASGSSPASSYLENSSVWYPTGTH 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 46/52 (88%)
dlx5NP_001004778.1 DLL_N 26..118 CDD:315147 27/104 (26%)
Homeobox 140..193 CDD:306543 46/52 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416398at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47671
Panther 1 1.100 - - O PTHR24327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X884
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.