DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and nkx6.1

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001002475.1 Gene:nkx6.1 / 436748 ZFINID:ZDB-GENE-040718-178 Length:312 Species:Danio rerio


Alignment Length:283 Identity:79/283 - (27%)
Similarity:108/283 - (38%) Gaps:72/283 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAPDAPHTPKYMDG-----GNTAASVTPGINIP----------GKSAFVELQQHAAAGYGGIRS 50
            |..|..|..|....|     ..||.|..|| .||          |.||....||.|.|...||..
Zfish    31 MKTPLYPAYPLSSTGPASSTSPTATSPNPG-GIPVSSPGIKTSSGLSALASAQQCAIATPHGIND 94

  Fly    51 TYQHFGPQ-----GGQDSGFPSPRSALGYPFPP--MHQNSYSGYHLGSYAPPCA----------- 97
            ....  |.     .|..||.|. .|:|..|.||  ....|.:...:..|..|..           
Zfish    95 ILSR--PSVACSPAGILSGLPR-FSSLSPPPPPGLYFSPSAAAVAVARYPKPLTELPGRTPIFWP 156

  Fly    98 ----SPPKDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELA 158
                ||...|...:.....:.:.::..||: :..|..:|..|:..|.:.|::|:|||.||||.||
Zfish   157 GVMQSPHWRDARFACSPHQNSVLLDKDGKR-KHTRPTFSGQQIFALEKTFEQTKYLAGPERARLA 220

  Fly   159 ASLGLTQTQVKIWFQNRRSKYKKM----MKAAQGPGTNSGMPLGGGGPNPG-------------- 205
            .|||:|::|||:||||||:|::|.    |.:|:....:....|.|...|..              
Zfish   221 YSLGMTESQVKVWFQNRRTKWRKRHAAEMASAKKKQDSETERLKGASENEDDDDDYNKPLDPNSD 285

  Fly   206 ---------QHSPNQ---MHSGE 216
                     :|.||.   :|:.|
Zfish   286 DEKITQLLKKHKPNSALIIHTSE 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 29/52 (56%)
nkx6.1NP_001002475.1 Homeobox 189..242 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.