DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and vax1

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_919391.2 Gene:vax1 / 373870 ZFINID:ZDB-GENE-030904-9 Length:317 Species:Danio rerio


Alignment Length:283 Identity:78/283 - (27%)
Similarity:109/283 - (38%) Gaps:85/283 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 QNSYSGYHL--------------GSYAPPCASPPKDDFSIS---DKCEDS--------------- 113
            |:|.||..|              ||.:.......::.||.|   :.||.|               
Zfish     7 QDSESGMLLKNGLKEGKEGKDSQGSISKTFLKDQQESFSPSGAVENCEKSRASSGDPDYCRRILV 71

  Fly   114 -----GLR--VNGKGKKMRKP---RTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQV 168
                 .:|  :..||..:.:|   ||.:::.||.:|...|||.||:...||.|||..|.|::|||
Zfish    72 RDAKGSIREIILPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQV 136

  Fly   169 KIWFQNRRSKYKK--------MMKAAQGPGTNSGMPLGGGGPNPGQHSPNQMHSGELANGRFLWA 225
            |:||||||:|.||        ....::...|.|.:.|              :..|.|.....|..
Zfish   137 KVWFQNRRTKQKKDQGKDSELRSVVSETAATCSVLRL--------------LEQGRLLTPPGLPG 187

  Fly   226 ALETNGTLALVHSTGG------NNGGGSNSGSPSHYLPPGHSPTP-SSTPVSELSPEFPPTGL-- 281
            .|...|:.:|..:..|      .|||.|:|.|.|    .|.|.|. .|.|:..::.....|||  
Zfish   188 LLPHCGSSSLGSALRGPSLGITANGGSSSSSSSS----AGSSGTAGGSPPLPTVTSSGTVTGLQG 248

  Fly   282 SPPTQAPWDQKPHWIDHKPPPQM 304
            |||.        |.:...|.|.:
Zfish   249 SPPA--------HGLFSFPMPSL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 29/55 (53%)
vax1NP_919391.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 13/54 (24%)
Homeobox 95..148 CDD:278475 28/52 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..248 16/48 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.