DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and cad

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster


Alignment Length:289 Identity:69/289 - (23%)
Similarity:98/289 - (33%) Gaps:105/289 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 APDAPHTPKY--------MDGGNTAASVTPGINIPGKSAFVELQQHAAAGYGGIRSTYQHFGPQG 59
            ||.||...:.        ..||......|.|  .|| ||....|||.|                 
  Fly   131 APGAPQLNETNSSIGVGGAGGGGGVGGATDG--GPG-SAPPNHQQHIA----------------- 175

  Fly    60 GQDSGFPSPR--------SALGYPFPPMHQNSYSGYHLGSYA----------------------- 93
               .|.|||.        |:.|.|......:.:..:||.:.|                       
  Fly   176 ---EGLPSPPITVSGSEISSPGAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNN 237

  Fly    94 ---------------------PPCASPPKDDFSISDKCEDSG--LRVNGKGKKMRKPRTIYSSLQ 135
                                 |...:.|:.|.|.|...||..  |..:||.:...|.|.:|:..|
  Fly   238 SVSNNNRTSPSKPPYFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQ 302

  Fly   136 LQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTNSGMPLGGG 200
            ..:|.:.:..::|:.:..::|||.:|.|::.||||||||||:|.:|..|....|..     :|.|
  Fly   303 RLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKKGSDPNV-----MGVG 362

  Fly   201 GPN--------------PGQH-SPNQMHS 214
            ..:              ||.| |.:..||
  Fly   363 VQHADYSQLLDAKAKLEPGLHLSHSLAHS 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 21/52 (40%)
cadNP_001260641.1 Homeobox 295..347 CDD:278475 21/51 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0850
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.