DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and NOTO

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001127934.1 Gene:NOTO / 344022 HGNCID:31839 Length:251 Species:Homo sapiens


Alignment Length:207 Identity:55/207 - (26%)
Similarity:84/207 - (40%) Gaps:47/207 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 APDAPHTPKYMDGGNTAASV----------TPGINIPGKSAFVELQQHAAAGY---GGIRSTYQH 54
            :|..|:||:......:..||          .|..:.|..||.|......||..   ||:      
Human    32 SPTGPNTPRAPGRFESPFSVEAILARPDPCAPAASQPSGSACVHPAFWTAASLCATGGL------ 90

  Fly    55 FGPQGGQDSGFPSPRSALGYPFPPMHQNSYSG------------YHLGSYAPPCASPPKDDFSIS 107
              |.....|..|:..|...||.|........|            :..|.:|.|..:|.:|     
Human    91 --PWACPTSWLPAYLSVGFYPVPGPRVAPVCGLLGFGVTGLELAHCSGLWAFPDWAPTED----- 148

  Fly   108 DKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWF 172
                     :....::.::.||:::..||::|.:.|.:...|...:||:|||.|.||:.||::||
Human   149 ---------LQDTERQQKRVRTMFNLEQLEELEKVFAKQHNLVGKKRAQLAARLKLTENQVRVWF 204

  Fly   173 QNRRSKYKKMMK 184
            ||||.||:|..|
Human   205 QNRRVKYQKQQK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 24/52 (46%)
NOTONP_001127934.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47 4/14 (29%)
Homeobox 160..211 CDD:278475 23/50 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 224..251
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.