DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and B-H1

DIOPT Version :10

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster


Alignment Length:110 Identity:24/110 - (21%)
Similarity:34/110 - (30%) Gaps:47/110 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 MFDFSFDLEAFAGQMEEQANPAFKEYHGLLNITKITPFN--SLASYHPKTRDLAFKLKRSKFVIE 332
            ::|.|...|:|..|:....||             :.|.|  :.|.|                   
  Fly    98 LYDLSNIFESFLPQLLTYPNP-------------VDPLNGDAAAMY------------------- 130

  Fly   333 KLHLPPD----IAD------EDGASKSQVPAMSCASVGGKSKLDF 367
             ||.|.:    :||      .:.|.:.|.|..|..|....|  ||
  Fly   131 -LHKPEEYRKKVADYVRRYATEEALREQDPTESSDSESSMS--DF 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeodomain 125..181 CDD:459649
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.