DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and B-H2

DIOPT Version :10

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster


Alignment Length:125 Identity:26/125 - (20%)
Similarity:43/125 - (34%) Gaps:33/125 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LPTPLE--ESKTADNNSTMPEPETMRIAFRYNQLTPVDSEQKPATSLGHYFDLTKTMSPDMLLAH 154
            :|:|.|  :..:...:.|:..|....|.||....|...:.:|.      .:||            
  Fly   227 IPSPFEYADVVSTTTHKTLRGPRAGVIFFRKGVRTVKANGEKV------MYDL------------ 273

  Fly   155 DVTCWNGGELETNAPEF-GSFNNPH---YASLLSCIRSKAGEQQFNAASDESSKNVLRIC 210
                    |...|...| |....||   .|.:.:|: .:|...:|.|..::..||...:|
  Fly   274 --------ESRINQAVFPGLQGGPHNHAIAGIATCM-LQAQSPEFRAYQEQVIKNARALC 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeodomain 125..181 CDD:459649 9/59 (15%)
B-H2NP_523386.1 Homeodomain 381..437 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.