DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and HOXD13

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_000514.2 Gene:HOXD13 / 3239 HGNCID:5136 Length:343 Species:Homo sapiens


Alignment Length:206 Identity:55/206 - (26%)
Similarity:82/206 - (39%) Gaps:52/206 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 APH-------TPKYMDGGNTAASVTPGINIPGKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQDS 63
            :||       ..||||....|:|..|...:|.::..|..       |.|..|.|||.       .
Human   154 SPHASLGGFPVEKYMDVSGLASSSVPANEVPARAKEVSF-------YQGYTSPYQHV-------P 204

  Fly    64 GFPSPRSALGYPFPPMHQN--SYSGYH-------------------LGSYAPPCASPPKDDFSIS 107
            |:....|..| ...|.|:.  |..||.                   .||:....:.|.....:..
Human   205 GYIDMVSTFG-SGEPRHEAYISMEGYQSWTLANGWNSQVYCTKDQPQGSHFWKSSFPGDVALNQP 268

  Fly   108 DKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWF 172
            |.|      |..:|:|.|.|   |:.|||::|...:...:::...:|..::|:..|::.||.|||
Human   269 DMC------VYRRGRKKRVP---YTKLQLKELENEYAINKFINKDKRRRISAATNLSERQVTIWF 324

  Fly   173 QNRRSKYKKMM 183
            ||||.|.||::
Human   325 QNRRVKDKKIV 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 19/52 (37%)
HOXD13NP_000514.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
HoxA13_N 39..174 CDD:289085 6/19 (32%)
polyalanine repeat 57..71
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..115
homeodomain 277..333 CDD:238039 21/58 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.