Sequence 1: | NP_001137759.1 | Gene: | Dll / 37973 | FlyBaseID: | FBgn0000157 | Length: | 347 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_000514.2 | Gene: | HOXD13 / 3239 | HGNCID: | 5136 | Length: | 343 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 55/206 - (26%) |
---|---|---|---|
Similarity: | 82/206 - (39%) | Gaps: | 52/206 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 APH-------TPKYMDGGNTAASVTPGINIPGKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQDS 63
Fly 64 GFPSPRSALGYPFPPMHQN--SYSGYH-------------------LGSYAPPCASPPKDDFSIS 107
Fly 108 DKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWF 172
Fly 173 QNRRSKYKKMM 183 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dll | NP_001137759.1 | Homeobox | 127..180 | CDD:278475 | 19/52 (37%) |
HOXD13 | NP_000514.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..28 | ||
HoxA13_N | 39..174 | CDD:289085 | 6/19 (32%) | ||
polyalanine repeat | 57..71 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 78..115 | ||||
homeodomain | 277..333 | CDD:238039 | 21/58 (36%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |