DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and HOXC13

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_059106.2 Gene:HOXC13 / 3229 HGNCID:5125 Length:330 Species:Homo sapiens


Alignment Length:196 Identity:50/196 - (25%)
Similarity:80/196 - (40%) Gaps:64/196 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PKYMDGGNTAASVTPGIN---IPGKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQDS----GFPS 67
            |.|:|     .||.|||:   .|...|.:.::            .|||:....|.||    ....
Human   186 PGYLD-----VSVVPGISGHPEPRHDALIPVE------------GYQHWALSNGWDSQVYCSKEQ 233

  Fly    68 PRSALGY--PFP---PMHQNSYSGYHLGSYAPPCASPPKDDFSISDKCEDSGLRVNGKGKKMRKP 127
            .:||..:  |||   |: |...|.|..|                                  ||.
Human   234 SQSAHLWKSPFPDVVPL-QPEVSSYRRG----------------------------------RKK 263

  Fly   128 RTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTN 192
            |..|:.:||::|.:.:..::::...:|..::|:..|::.||.|||||||.|.||::..::.|..:
Human   264 RVPYTKVQLKELEKEYAASKFITKEKRRRISATTNLSERQVTIWFQNRRVKEKKVVSKSKAPHLH 328

  Fly   193 S 193
            |
Human   329 S 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 18/52 (35%)
HOXC13NP_059106.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..50
HoxA13_N 54..166 CDD:315049
HOX 260..312 CDD:197696 18/85 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.