Sequence 1: | NP_001137759.1 | Gene: | Dll / 37973 | FlyBaseID: | FBgn0000157 | Length: | 347 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_059106.2 | Gene: | HOXC13 / 3229 | HGNCID: | 5125 | Length: | 330 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 50/196 - (25%) |
---|---|---|---|
Similarity: | 80/196 - (40%) | Gaps: | 64/196 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 PKYMDGGNTAASVTPGIN---IPGKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQDS----GFPS 67
Fly 68 PRSALGY--PFP---PMHQNSYSGYHLGSYAPPCASPPKDDFSISDKCEDSGLRVNGKGKKMRKP 127
Fly 128 RTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTN 192
Fly 193 S 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dll | NP_001137759.1 | Homeobox | 127..180 | CDD:278475 | 18/52 (35%) |
HOXC13 | NP_059106.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 30..50 | ||
HoxA13_N | 54..166 | CDD:315049 | |||
HOX | 260..312 | CDD:197696 | 18/85 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |