DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and HOXA7

DIOPT Version :10

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_008827.2 Gene:HOXA7 / 3204 HGNCID:5108 Length:230 Species:Homo sapiens


Alignment Length:70 Identity:20/70 - (28%)
Similarity:26/70 - (37%) Gaps:6/70 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 FGGGFPIGSIIGIEDKHGNYARVLSKYFLAEGIVNKHPLVVAIMDEDATQL-----INKLPTPLE 97
            |..|...|.|:.....|.....|...|.|.:||| |.||....:.....:|     |..:|..:.
Human   160 FANGRSTGLILDSGATHTTAIPVHDGYVLQQGIV-KSPLAGDFITMQCRELFQEMNIELIPPYMI 223

  Fly    98 ESKTA 102
            .||.|
Human   224 ASKEA 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeodomain 125..181 CDD:459649
HOXA7NP_008827.2 Antp-type hexapeptide 119..124
Homeodomain 131..187 CDD:459649 6/26 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..230 13/43 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.