DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and HOXA2

DIOPT Version :10

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_006726.1 Gene:HOXA2 / 3199 HGNCID:5103 Length:376 Species:Homo sapiens


Alignment Length:70 Identity:23/70 - (32%)
Similarity:35/70 - (50%) Gaps:9/70 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 SPDMLLAHDVTCWNGGELETNAPEFGSFNNPHY-ASLLSCIRSKAGEQQFNAASDESSKNVLRIC 210
            ||:::|.||.:..:.|.|..:| ...|.::.|. :||:|...|||..||       |:...|.|.
Human    46 SPELILDHDHSSPSTGHLPPDA-VISSADDTHADSSLMSQTISKAQIQQ-------SAHTHLNIP 102

  Fly   211 LNSMG 215
            |..:|
Human   103 LFPLG 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeodomain 125..181 CDD:459649 10/34 (29%)
HOXA2NP_006726.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..93 16/47 (34%)
Antp-type hexapeptide 94..99 1/4 (25%)
Homeodomain 144..200 CDD:459649
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..229
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..279
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.