DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and Hoxc13

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:XP_235695.3 Gene:Hoxc13 / 315337 RGDID:1563984 Length:328 Species:Rattus norvegicus


Alignment Length:305 Identity:65/305 - (21%)
Similarity:99/305 - (32%) Gaps:145/305 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GGNTAASVTPGINIPGKSAFVELQQHAAAGYGG------IRSTYQH----------FGPQGGQDS 63
            ||.:.||       |||:..::       |.||      .|....|          ..|||...:
  Rat    42 GGCSGAS-------PGKAPSMD-------GLGGSCPASHCRDLLPHPVLARPPAPLGAPQGAVYT 92

  Fly    64 GFPSPRSA----------------LGYPFPPMHQNSYSG---------------YHLG-SYAPPC 96
            ..|:|.:|                |||.:|  ...||.|               ||.| .|..|.
  Rat    93 DIPAPEAARQCAPPPAPPTSSSATLGYGYP--FGGSYYGCRLSHNVNLQQKPCSYHPGDKYPEPS 155

  Fly    97 ASPPKDDFS------------------------------ISDKCE---DSGLRVNG--------- 119
            .:.|.||.|                              ||...|   |:.:.|.|         
  Rat   156 GALPGDDLSSRAKEFAFYPSFASSYQAMPGYLDVSVVPGISGHPEPRHDALIPVEGYQHWALSNG 220

  Fly   120 ------------------------------------KGKKMRKPRTIYSSLQLQQLNRRFQRTQY 148
                                                :|:|.|.|   |:.:||::|.:.:..:::
  Rat   221 WDSQVYCSKEQSQSAHLWKSPFPDVVPLQPEVSSYRRGRKKRVP---YTKVQLKELEKEYAASKF 282

  Fly   149 LALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTNS 193
            :...:|..::|:..|::.||.|||||||.|.||::..::.|..:|
  Rat   283 ITKEKRRRISATTNLSERQVTIWFQNRRVKEKKVVSKSKAPHLHS 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 18/52 (35%)
Hoxc13XP_235695.3 HoxA13_N 52..164 CDD:289085 26/120 (22%)
HOX 258..310 CDD:197696 18/54 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.