Sequence 1: | NP_001137759.1 | Gene: | Dll / 37973 | FlyBaseID: | FBgn0000157 | Length: | 347 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_235695.3 | Gene: | Hoxc13 / 315337 | RGDID: | 1563984 | Length: | 328 | Species: | Rattus norvegicus |
Alignment Length: | 305 | Identity: | 65/305 - (21%) |
---|---|---|---|
Similarity: | 99/305 - (32%) | Gaps: | 145/305 - (47%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 GGNTAASVTPGINIPGKSAFVELQQHAAAGYGG------IRSTYQH----------FGPQGGQDS 63
Fly 64 GFPSPRSA----------------LGYPFPPMHQNSYSG---------------YHLG-SYAPPC 96
Fly 97 ASPPKDDFS------------------------------ISDKCE---DSGLRVNG--------- 119
Fly 120 ------------------------------------KGKKMRKPRTIYSSLQLQQLNRRFQRTQY 148
Fly 149 LALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTNS 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dll | NP_001137759.1 | Homeobox | 127..180 | CDD:278475 | 18/52 (35%) |
Hoxc13 | XP_235695.3 | HoxA13_N | 52..164 | CDD:289085 | 26/120 (22%) |
HOX | 258..310 | CDD:197696 | 18/54 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |