DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and dlx6a

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_571398.1 Gene:dlx6a / 30586 ZFINID:ZDB-GENE-980526-448 Length:247 Species:Danio rerio


Alignment Length:306 Identity:106/306 - (34%)
Similarity:138/306 - (45%) Gaps:96/306 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TAASVTPGINI--PGKSAFVEL--QQH--------AAAGY------GGIRSTYQH-FGPQGGQDS 63
            |..::..|:..  ..||||:|.  |.|        ||:.|      .|....:|| ..|..|.:|
Zfish     3 TMTTMADGLEAQDSSKSAFMEFGQQSHSQQSSPSMAASHYPLHCLHSGSHHHHQHDSSPYSGSNS 67

  Fly    64 GFPS-PRSALGYPFPPMHQNSY-SGYHLGSYAPPCASPPKDDFSISDK---CEDSGLRVNGKGKK 123
            ...| |.|.:.:|    |.:.| ..||..:    ..:..:.|.:...|   .|:..:|.||||||
Zfish    68 YNRSLPYSYVSHP----HHSPYLPSYHSNA----SGTQTRLDATEQQKTTVIENGEIRFNGKGKK 124

  Fly   124 MRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQG 188
            :|||||||||||||.||.|||:|||||||||||||||||||||||||||||:|||:||::|.   
Zfish   125 IRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQ--- 186

  Fly   189 PGTNSGMPLGGGGPNPGQHSPNQMHSGELANGRFLWAALETNGTLALVHSTGGNNGGGSNSGSPS 253
                      ||.|:.....|                     |::||                  
Zfish   187 ----------GGNPHETDTLP---------------------GSIAL------------------ 202

  Fly   254 HYLPPGHSP-TPSSTPVSELSPEFPPTGLSPPTQAP----WDQKPH 294
                   || :|:..|:.::|.......:|..:..|    |...||
Zfish   203 -------SPRSPAIPPIWDVSASSKGVNMSANSYMPGYSHWYSSPH 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 48/52 (92%)
dlx6aNP_571398.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..66 11/43 (26%)
Homeobox 128..181 CDD:278475 48/52 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I6305
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4422
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416398at2759
OrthoFinder 1 1.000 - - FOG0000655
OrthoInspector 1 1.000 - - otm25468
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24327
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X884
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1010.020

Return to query results.
Submit another query.