DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and dlx4b

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_571393.1 Gene:dlx4b / 30581 ZFINID:ZDB-GENE-990415-50 Length:254 Species:Danio rerio


Alignment Length:268 Identity:107/268 - (39%)
Similarity:135/268 - (50%) Gaps:66/268 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PGKSAFVELQQHAAAGYGGIRSTYQHFG-------PQGGQDSG------FPSPRSA------LGY 74
            |.||||:|.      |: |:.|..||..       |..|..||      .|.|.||      |||
Zfish    16 PSKSAFLEF------GH-GLASNQQHLSGFAHNIYPVHGLHSGGHLQHDAPYPSSAPHYSRPLGY 73

  Fly    75 PFP-PMH---QNSYSGYHLGSYAPPCASPPKDDFSISDKC--EDSGLRVNGKGKKMRKPRTIYSS 133
            .:| |:.   ..:|..|...:::...|....:|.:.....  |:..:|:||||||:|||||||||
Zfish    74 AYPGPVSAAAPGAYMPYQPNNHSGALAHTRAEDTNHEKPAVIENGEIRLNGKGKKIRKPRTIYSS 138

  Fly   134 LQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMK-AAQGP-----GTN 192
            :|||.|::|||:||||||||||:|||.||||||||||||||:||||||:|| .:.||     .|:
Zfish   139 VQLQALHQRFQQTQYLALPERADLAAKLGLTQTQVKIWFQNKRSKYKKIMKHGSSGPEGELLHTS 203

  Fly   193 SGMPLGGGGPNPGQHSPNQMHSGELANGRFLWAALETNGTLALVHSTGGNNGGGSNSGSPSHYLP 257
            |..|.     :||...              ||.....|....:..|:..||.|        |:.|
Zfish   204 SSSPC-----SPGLSQ--------------LWEVSMANKVPPMHPSSYMNNYG--------HWYP 241

  Fly   258 PGH-SPTP 264
            |.| .|.|
Zfish   242 PHHQDPVP 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 44/52 (85%)
dlx4bNP_571393.1 Homeobox 132..185 CDD:278475 44/52 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588203
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4422
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416398at2759
OrthoFinder 1 1.000 - - FOG0000655
OrthoInspector 1 1.000 - - otm25468
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X884
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.860

Return to query results.
Submit another query.