DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and dlx5a

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_571381.2 Gene:dlx5a / 30569 ZFINID:ZDB-GENE-990415-49 Length:282 Species:Danio rerio


Alignment Length:279 Identity:99/279 - (35%)
Similarity:115/279 - (41%) Gaps:120/279 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 HFGPQGGQDSGFPSPR-------------------------SALGYPFPPMHQNSYS-GYH--LG 90
            ::.|.||...|:.||.                         ||..||    ...||| .||  .|
Zfish    46 YYSPAGGVHHGYCSPNSGTYGKPLNAYQYQYHGVNGSSGNYSAKSYP----DYGSYSTAYHQYAG 106

  Fly    91 SYAPPCASPPKDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERA 155
            :|....:.|...:   .:..|.....||||.||:|||||||||.||..|.||||.||||||||||
Zfish   107 TYNRVQSQPSPQE---KETAEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQNTQYLALPERA 168

  Fly   156 ELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTNSGMPLGGGGPNPGQHSPNQMHSGELANG 220
            |||||||||||||||||||:|||.||:||                                  ||
Zfish   169 ELAASLGLTQTQVKIWFQNKRSKLKKIMK----------------------------------NG 199

  Fly   221 RFLWAALETNGTLALVHSTGGNNGGGSNSGSPSHYLPPGHSPTPSSTPVSELSPEFPPTGLSPPT 285
            .                                  |||.|||: ||.|::..||:.|        
Zfish   200 E----------------------------------LPPEHSPS-SSDPMACNSPQSP-------- 221

  Fly   286 QAPWD----QKPHWIDHKP 300
             |.||    |:||   |:|
Zfish   222 -AVWDSQGPQRPH---HQP 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 46/52 (88%)
dlx5aNP_571381.2 DLL_N 31..118 CDD:289198 18/75 (24%)
Homeobox 140..193 CDD:278475 46/52 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588195
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416398at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X884
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.