DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and dlx4a

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_571375.1 Gene:dlx4a / 30561 ZFINID:ZDB-GENE-980526-73 Length:250 Species:Danio rerio


Alignment Length:229 Identity:101/229 - (44%)
Similarity:127/229 - (55%) Gaps:41/229 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PGKSAFVEL-------QQHAAAGYGGIRSTYQ-----HFGPQGGQDSGFPSPRSALGYPFPPMHQ 81
            |.||||:|.       |||:.    |:...:.     |.|.....|:.| || .|..|..|..:.
Zfish    15 PSKSAFLEFSHGYQSHQQHSP----GVSHAHYPVHGLHQGAHSQYDAAF-SP-GAASYSRPLAYH 73

  Fly    82 NSYSGYHLGSYAP----PCASPPKDDFSISDK---CEDSGLRVNGKGKKMRKPRTIYSSLQLQQL 139
            .|.:.:|.|:|.|    ......:.:.:.|:|   .|...:|:||||||:|||||||||||||.|
Zfish    74 YSTAHHHPGAYLPYQHNSAVGYSRVEDADSEKQSSIESGEIRLNGKGKKIRKPRTIYSSLQLQAL 138

  Fly   140 NRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMK-AAQGP-------GTNSGMP 196
            |:|||:||||||||||:|||.||||||||||||||:||||||:|| .:.||       .:.||.|
Zfish   139 NQRFQQTQYLALPERADLAAKLGLTQTQVKIWFQNKRSKYKKIMKHGSSGPEGEHLQAASASGAP 203

  Fly   197 LGGGGP------NPGQHSPNQMHSGELANGRFLW 224
            ...|.|      .|.:.:|  :|||...|....|
Zfish   204 CSPGMPPLWDVSMPSKGAP--IHSGGYMNSFGHW 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 46/52 (88%)
dlx4aNP_571375.1 COG5576 98..206 CDD:227863 68/107 (64%)
Homeobox 126..179 CDD:278475 46/52 (88%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..202 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588204
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4422
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416398at2759
OrthoFinder 1 1.000 - - FOG0000655
OrthoInspector 1 1.000 - - otm25468
orthoMCL 1 0.900 - - OOG6_111810
Panther 1 1.100 - - O PTHR24327
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2574
SonicParanoid 1 1.000 - - X884
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.