DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and dlx2b

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_571372.1 Gene:dlx2b / 30557 ZFINID:ZDB-GENE-980526-18 Length:276 Species:Danio rerio


Alignment Length:308 Identity:109/308 - (35%)
Similarity:133/308 - (43%) Gaps:91/308 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PGINIPGKSAFVELQQHAAAG--YGGIRSTYQHFGPQGGQDSGFPSPRS-ALGYPFPPMHQNSYS 85
            |...:...|.|...|....||  |..:.|...|.|..|....   ||:: .|||      .:||.
Zfish    35 PVSTVTDSSFFSSSQTGHCAGTAYAQLASYSYHPGTVGNVHY---SPKAYDLGY------ASSYG 90

  Fly    86 GYHLGSY----APPCASPPKDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRT 146
            .|  |:|    :|....|.|::      .|.....||||.||:|||||||||.||..|.||||:|
Zfish    91 AY--GTYGASSSPTPTEPEKEE------SEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKT 147

  Fly   147 QYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTNSGMPLGGGGPNPGQHSPNQ 211
            ||||||||||||||||||||||||||||||||:||:.|..:.|                  :..|
Zfish   148 QYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKLWKNGEIP------------------ADQQ 194

  Fly   212 MHSGELANGRFLWAALETNGTLALVHSTGGNNGGGSNSGSPSHYLPP----GHSPTPSSTPVSEL 272
            :.||:                                  |||...||    ...|.|:......:
Zfish   195 VASGD----------------------------------SPSSSPPPQAGWDFPPNPTQNDGDTV 225

  Fly   273 SPEFPPTGLSPPTQAP-------WDQKPHWIDHKPPPQMTPQPPHPAA 313
            |.:  ||| .|.|.||       |....:.:.|..|..:. ||.|.:|
Zfish   226 SEQ--PTG-PPNTTAPSFLTNYSWYSSTNAVTHLQPSTLI-QPHHSSA 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 47/52 (90%)
dlx2bNP_571372.1 DLL_N 29..102 CDD:289198 21/77 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 97..123 8/31 (26%)
Homeobox 128..181 CDD:278475 47/52 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..238 16/83 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588201
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416398at2759
OrthoFinder 1 1.000 - - FOG0000655
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.