DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and emx2

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_571355.2 Gene:emx2 / 30537 ZFINID:ZDB-GENE-990415-54 Length:247 Species:Danio rerio


Alignment Length:172 Identity:52/172 - (30%)
Similarity:77/172 - (44%) Gaps:29/172 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AASVTPGINIPGKSAFVELQQHAAAGY--GGIRSTYQHFGPQGGQDSGFPSPRSALGYPFPPMHQ 81
            |.|..|...:|..|.   ...||.|.:  ....|.:..|..|....|.|        ||: .:|:
Zfish    69 AVSHPPNSAVPVHSV---PPPHALAAHPLSSSHSPHPLFASQQRDPSTF--------YPW-LIHR 121

  Fly    82 NSYSGYHLGSYAPPCASPPKDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRT 146
            ..|.|:.               |..::...:|.|..|...:|.::.||.:|..||.:|...|::.
Zfish   122 YRYLGHR---------------FQGNETSPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKN 171

  Fly   147 QYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQG 188
            .|:...||.:||.||.||:||||:||||||:|:|:.....:|
Zfish   172 HYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQKLEEEG 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 27/52 (52%)
emx2NP_571355.2 Homeobox 153..205 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.