DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and emx3

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_571354.1 Gene:emx3 / 30536 ZFINID:ZDB-GENE-990415-53 Length:233 Species:Danio rerio


Alignment Length:189 Identity:52/189 - (27%)
Similarity:82/189 - (43%) Gaps:37/189 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 APHTPKYMDGGNTAASVTPGINIPGKSAFVELQQHAAAGYGGIR----STYQHFGPQGGQDSGFP 66
            :|....:.:.|.|..|.:|      :..|.:...|:......:|    .|...|.|.        
Zfish    44 SPFGSCFQNSGRTLYSSSP------EMMFTDPSTHSTNSGLSLRHLQIPTQPFFSPH-------- 94

  Fly    67 SPRSALGYPFPPMHQNSYSGYHLGSYAPPCASPPKDDFSISDKCEDSGLRVNGK-GKKMRKPRTI 130
             .|..|.: :|.:.:|.|.|:....          ||.|      ...|.::|. .:|.::.||.
Zfish    95 -QRDTLNF-YPWVLRNRYLGHRFQG----------DDSS------PENLLLHGPFSRKPKRIRTA 141

  Fly   131 YSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQGP 189
            :|..||.:|.|.|::..|:...||.:||..|.||:||||:||||||:|:|:.....:.|
Zfish   142 FSPSQLLRLERAFEKNHYVVGAERKQLANGLCLTETQVKVWFQNRRTKHKRQKLEEESP 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 27/52 (52%)
emx3NP_571354.1 Homeobox 139..191 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.