DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and msx1a

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_571348.1 Gene:msx1a / 30527 ZFINID:ZDB-GENE-980526-312 Length:233 Species:Danio rerio


Alignment Length:140 Identity:54/140 - (38%)
Similarity:73/140 - (52%) Gaps:28/140 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 YAPPCASPPKDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAE 156
            ::|...|||        .|.   ||   |.|..|||||.:|:.||..|.|:|::.|||::.||||
Zfish    93 FSPSRLSPP--------ACP---LR---KHKTNRKPRTPFSTAQLLALERKFRQKQYLSIAERAE 143

  Fly   157 LAASLGLTQTQVKIWFQNRRSKYKKMMKA-----------AQGPGTNSGMPLGGGGP--NPGQHS 208
            .::||.||:|||||||||||:|.|::.:|           ...|......|.|...|  :.|.| 
Zfish   144 FSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPLLPPAFGISFPAGAHIPAYSAGSH- 207

  Fly   209 PNQMHSGELA 218
            |...||..::
Zfish   208 PFHRHSANVS 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 32/52 (62%)
msx1aNP_571348.1 Homeobox 114..167 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.