DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and hoxd13a

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_571244.2 Gene:hoxd13a / 30407 ZFINID:ZDB-GENE-990415-119 Length:256 Species:Danio rerio


Alignment Length:62 Identity:26/62 - (41%)
Similarity:39/62 - (62%) Gaps:3/62 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKK 181
            :|:|.|.|   |:..||::|.|.:..|:::....|..:|:|..|::.||.|||||||.|.||
Zfish   190 RGRKKRVP---YTKFQLKELEREYNTTKFITKENRRRIASSTNLSERQVTIWFQNRRVKDKK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 21/52 (40%)
hoxd13aNP_571244.2 HoxA13_N 16..>71 CDD:289085
Homeobox 194..247 CDD:278475 22/55 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.