powered by:
Protein Alignment Dll and hoxd13a
DIOPT Version :9
Sequence 1: | NP_001137759.1 |
Gene: | Dll / 37973 |
FlyBaseID: | FBgn0000157 |
Length: | 347 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_571244.2 |
Gene: | hoxd13a / 30407 |
ZFINID: | ZDB-GENE-990415-119 |
Length: | 256 |
Species: | Danio rerio |
Alignment Length: | 62 |
Identity: | 26/62 - (41%) |
Similarity: | 39/62 - (62%) |
Gaps: | 3/62 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 120 KGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKK 181
:|:|.|.| |:..||::|.|.:..|:::....|..:|:|..|::.||.|||||||.|.||
Zfish 190 RGRKKRVP---YTKFQLKELEREYNTTKFITKENRRRIASSTNLSERQVTIWFQNRRVKDKK 248
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
0 | 0.000 |
|
Return to query results.
Submit another query.