DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and dbx1a

DIOPT Version :10

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_571233.1 Gene:dbx1a / 30394 ZFINID:ZDB-GENE-000128-8 Length:314 Species:Danio rerio


Alignment Length:147 Identity:51/147 - (34%)
Similarity:71/147 - (48%) Gaps:32/147 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TYQHFGPQGGQDSGF--PSPRSALGYPFPP----MHQNSYS-GYHLGSYAP-------PCAS--- 98
            ||..||.     |..  |||:.|..   ||    :|...:| .|..||:.|       |..|   
Zfish   100 TYLKFGV-----SAILAPSPKKATS---PPSVHSIHPKGFSVPYFDGSFCPFVRSSYFPAPSSVV 156

  Fly    99 PPKDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGL 163
            |....||..       |...||.::....|.::|.:|.:.|.:.||:.:|::.|:|.:|||.|||
Zfish   157 PIPGTFSWP-------LAARGKPRRGMLRRAVFSDVQRKALEKMFQKQKYISKPDRKKLAAKLGL 214

  Fly   164 TQTQVKIWFQNRRSKYK 180
            ..:||||||||||.|::
Zfish   215 KDSQVKIWFQNRRMKWR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeodomain 125..181 CDD:459649 26/56 (46%)
dbx1aNP_571233.1 Homeodomain 178..232 CDD:459649 26/54 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..279
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..314
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.