DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and Dlx4

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001100510.1 Gene:Dlx4 / 303469 RGDID:1308744 Length:238 Species:Rattus norvegicus


Alignment Length:248 Identity:93/248 - (37%)
Similarity:124/248 - (50%) Gaps:54/248 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PKYMDGGNTAASVTPGINIPGKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQDSGFPSPRSALGY 74
            |......:..|:...|:: ||.:|..:|.  .:..||.:.| |.:.||....||...|.:.:.. 
  Rat    19 PDLAPASSVVAAYQLGLS-PGTAASPDLS--FSQTYGHLLS-YSYPGPATPGDSYLSSQQQSAA- 78

  Fly    75 PFPPMHQNSYSGYHLGSYAPPCASPPK-----DDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSL 134
            |..|.||             |...|.:     :..::|.:.....|.     :|:||||||||||
  Rat    79 PSRPFHQ-------------PTEHPQELEAESEKLALSLEPSQPSLT-----RKLRKPRTIYSSL 125

  Fly   135 QLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTN--SGMPL 197
            |||.||:|||.||||||||||:|||.||||||||||||||:||||||::|.:.|....  ||.| 
  Rat   126 QLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQSSGELEEDFSGRP- 189

  Fly   198 GGGGPNPGQHS---PNQMHSGELANGRFLWAALETNGTLALVHSTGGNNGGGS 247
                |:...||   |:            :| .|...|||.   ::|.:|..|:
  Rat   190 ----PSLSPHSLTLPS------------IW-DLPKAGTLP---TSGYDNSFGT 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 46/52 (88%)
Dlx4NP_001100510.1 Homeobox 118..172 CDD:395001 47/53 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346760
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416398at2759
OrthoFinder 1 1.000 - - FOG0000655
OrthoInspector 1 1.000 - - otm44633
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24327
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.900

Return to query results.
Submit another query.