DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and noto

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_571130.1 Gene:noto / 30260 ZFINID:ZDB-GENE-990415-75 Length:241 Species:Danio rerio


Alignment Length:140 Identity:45/140 - (32%)
Similarity:66/140 - (47%) Gaps:36/140 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PSPRSALGYPFPPMHQNSYS--------GYHLGSYAPPCASPPKDDFSISDKC------EDSGL- 115
            |...|||...:..|...:||        ||.:..|.|         ::....|      :|:.| 
Zfish    64 PVSSSALPLIYSQMPHFAYSQSIMQTQTGYPVFCYPP---------YNFQTTCRGAVYAQDAVLA 119

  Fly   116 ---------RVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIW 171
                     ..:||.|:|   ||.:::.||.:|.:.|.|.||:...||..||::|.||:.|||:|
Zfish   120 KAAVHSHYKHKSGKSKRM---RTSFTNDQLSRLEKEFARQQYMVGSERFLLASALQLTEAQVKVW 181

  Fly   172 FQNRRSKYKK 181
            |||||.|::|
Zfish   182 FQNRRIKWRK 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 26/52 (50%)
notoNP_571130.1 COG5576 79..>193 CDD:227863 40/125 (32%)
Homeobox 138..190 CDD:278475 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.