DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and en2b

DIOPT Version :10

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_571115.1 Gene:en2b / 30238 ZFINID:ZDB-GENE-980526-40 Length:261 Species:Danio rerio


Alignment Length:60 Identity:29/60 - (48%)
Similarity:42/60 - (70%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 KKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKK 181
            |:.::|||.:::.|||:|...||..:||....|..||..|||.::|:||||||:|:|.||
Zfish   170 KEDKRPRTAFTAEQLQRLKNEFQNNRYLTEQRRQALAQELGLNESQIKIWFQNKRAKIKK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeodomain 125..181 CDD:459649 26/55 (47%)
en2bNP_571115.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..125
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..176 1/5 (20%)
Homeodomain 173..229 CDD:459649 26/55 (47%)
Engrail_1_C_sig 230..260 CDD:431338 29/60 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.