DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and Dlx2

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001178675.1 Gene:Dlx2 / 296499 RGDID:1304853 Length:332 Species:Rattus norvegicus


Alignment Length:370 Identity:124/370 - (33%)
Similarity:151/370 - (40%) Gaps:139/370 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HTPKYMDGGNTAASVTPGINIPGKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQDSGFPSPRSAL 72
            |.|:        .|.|..::....|::...|||.|.|.||..|.|.|.|......||        
  Rat    51 HKPQ--------ESPTLPVSTATDSSYYTNQQHPAGGGGGGASPYAHMGSYQYHASG-------- 99

  Fly    73 GYPFPPMHQNSY---SGYHLG------SYAPPCAS-------PPKDDFSISDKCEDSGLR-VNGK 120
                  ::..||   |.|.||      ||||...|       |.|:|.       :..:| ||||
  Rat   100 ------LNNVSYSAKSSYDLGYTAAYTSYAPYGTSSSPVNNEPDKEDL-------EPEIRIVNGK 151

  Fly   121 GKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKA 185
            .||:|||||||||.||..|.||||:|||||||||||||||||||||||||||||||||:|||.|:
  Rat   152 PKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKMWKS 216

  Fly   186 A-----QGPGTNSGMP-------------------LGGGGPNPGQHSPNQMHSGELANGRFLWAA 226
            .     |.||.::..|                   :.||||..|                     
  Rat   217 GEIPTEQHPGASASPPCASPPVSAPASWDFGAQQRMAGGGPGSG--------------------- 260

  Fly   227 LETNGTLALVHSTGGNNGGGSNSGSPSHYL---PPGHSPTPSSTPVSELSPEFPPTGLSPPTQAP 288
                       .:|..:.|.|.|.:.|.:|   |..|..:.|::.:...:|              
  Rat   261 -----------GSGAGSSGSSPSSAASAFLGNYPWYHQASGSASHLQATAP-------------- 300

  Fly   289 WDQKPHWIDHKPPPQMTPQPPHPAATLHPQTHHHNPPPQMGGYVP 333
                   :.|   |..|||..|     |...|||     .||..|
  Rat   301 -------LLH---PSQTPQAHH-----HHHHHHH-----AGGGAP 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 47/52 (90%)
Dlx2NP_001178675.1 DLL_N 54..135 CDD:289198 27/102 (26%)
Homeobox 158..211 CDD:278475 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346762
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416398at2759
OrthoFinder 1 1.000 - - FOG0000655
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.