DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and VENTX

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_055283.1 Gene:VENTX / 27287 HGNCID:13639 Length:258 Species:Homo sapiens


Alignment Length:267 Identity:85/267 - (31%)
Similarity:108/267 - (40%) Gaps:63/267 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GPQGGQDSGFP-----SPRSALGYPFPPMHQNSYSGYHLGSYAPP----CASPPKDDFSISDKCE 111
            |||  |.|.|.     |..|..|    |.|....:.:.|||...|    .|..|....||.:...
Human    10 GPQ--QLSSFGSVDWLSQSSCSG----PTHTPRPADFSLGSLPGPGQTSGAREPPQAVSIKEAAG 68

  Fly   112 DSGL-----RVNGKGKK---MRKP--RTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQT 166
            .|.|     .:.|..|:   :|.|  ||.::..|::.|...||..|||:..||..||..:.|::.
Human    69 SSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEV 133

  Fly   167 QVKIWFQNRRSKYKKMMKAAQGPGTNSGMPLGGGGPNPGQHSPNQMH--SGELANGRFL---WAA 226
            |:|.||||||.|:|:.|   |.|..:|  |..|     ..|:|...:  |..||||..|   ||.
Human   134 QIKTWFQNRRMKHKRQM---QDPQLHS--PFSG-----SLHAPPAFYSTSSGLANGLQLLCPWAP 188

  Fly   227 LETNGTLALVHSTGG------------NNGGGSNSGSP--SHYLPPGHSPTPSSTPVSELSPE-- 275
            |  :|..||:...|.            .:.|.|..|.|  ||...||.   ||..|.....|.  
Human   189 L--SGPQALMLPPGSFWGLCQVAQEALASAGASCCGQPLASHPPTPGR---PSLGPALSTGPRGL 248

  Fly   276 --FPPTG 280
              .|.||
Human   249 CAMPQTG 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 24/54 (44%)
VENTXNP_055283.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..93 24/88 (27%)
Homeobox 95..147 CDD:306543 23/51 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..248 8/23 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153147
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.