DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and Obox5

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_663755.2 Gene:Obox5 / 252829 MGIID:2149035 Length:291 Species:Mus musculus


Alignment Length:319 Identity:68/319 - (21%)
Similarity:105/319 - (32%) Gaps:139/319 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VTPG------INIPGKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQDSGFPSPRSALGYPFPPMH 80
            ||||      :::|.::.   |||.:..                       |.|.:...|....:
Mouse    43 VTPGSTMQSSLSVPERNL---LQQESEG-----------------------SSRQSGSMPLSDKY 81

  Fly    81 QNSYSGYHLGSYAPPCASPPKDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQR 145
            .|..:|        |.||                       :|.||.||:|:..|.:.|.:.|..
Mouse    82 VNKQTG--------PMAS-----------------------RKFRKERTVYTKEQQRLLQKHFDE 115

  Fly   146 TQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKM----MKAAQGPGTNSGMPLGGG---GPN 203
            .||....:..|||.|:|:|:.::||||:|.|:||::|    :|.|        :|...|   ..:
Mouse   116 CQYPNEKKIMELAVSVGVTKMEIKIWFKNNRAKYRRMNLQNIKQA--------LPESNGISKAVS 172

  Fly   204 PGQHSPNQMHSGELANGRFLWAALETNGTLALVHSTGGNNGGGSNSGS----------------- 251
            ...|.|                     |::.:|.|   :||....||:                 
Mouse   173 ESTHFP---------------------GSIPVVAS---DNGESMCSGTFGEDSMPKFNCSQESSL 213

  Fly   252 ------------PSHYLPPGHSPTPSSTPVSELSPEF--------PPTGLSPPTQAPWD 290
                        |..||..||:|..:.......:.|:        .|..|:...|||.|
Mouse   214 YCFQACDGDMCCPQEYLLDGHAPVTAWNSGQSAAVEYQTDIAVAEAPVRLAYAAQAPED 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 21/52 (40%)
Obox5NP_663755.2 homeodomain 95..153 CDD:238039 24/57 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24327
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.