DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and Vax2

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_036042.1 Gene:Vax2 / 24113 MGIID:1346018 Length:292 Species:Mus musculus


Alignment Length:253 Identity:67/253 - (26%)
Similarity:93/253 - (36%) Gaps:80/253 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 DSGFPSPRSALGYPFPPMHQNSYSGYHLGSYAPPCASPPKDDFSISDKCEDSGLR---------V 117
            |:|..|||...|         :.:....||......|..:.....:|.|....:|         |
Mouse    37 DTGSASPREIAG---------TSASSPAGSRESGGDSDGQQALGETDHCRRILVRDAKGTIREIV 92

  Fly   118 NGKGKKMRKP---RTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKY 179
            ..||..:.:|   ||.:::.||.:|...|||.||:...||.|||..|.|::||||:||||||:|.
Mouse    93 LPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQ 157

  Fly   180 KK----------MMKAAQGPGTNSGMPLGGGGPNPGQHSPNQMHSGELANGRFLWAALETNGTLA 234
            ||          ...|::...|::.:.|                   |..||.| :.......||
Mouse   158 KKDQSRDLEKRASSSASEAFATSNVLRL-------------------LEQGRLL-SVPRAPSLLA 202

  Fly   235 LVHSTGGNNGGGSNSGSPSHYLPPGH---------------SPTPSSTPVSELSPEFP 277
            |.....|              ||..|               :|.||::..|.|.|..|
Mouse   203 LTPGLPG--------------LPASHRGTSLVDPRNSSPRLNPMPSASASSPLPPPLP 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 29/55 (53%)
Vax2NP_036042.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..74 9/45 (20%)
Homeobox 105..158 CDD:278475 28/52 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..242 8/48 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.