DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and Vax1

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_033527.1 Gene:Vax1 / 22326 MGIID:1277163 Length:338 Species:Mus musculus


Alignment Length:262 Identity:62/262 - (23%)
Similarity:92/262 - (35%) Gaps:94/262 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 QNSYSGYHLGSYAPPCASPPKDDFSISDKCEDSGLR---------VNGKGKKMRKP---RTIYSS 133
            |.::||   ...:..|.....:..:..|.|....:|         :..||..:.:|   ||.:::
Mouse    48 QGAFSG---SGASEDCNKSKSNSSADPDYCRRILVRDAKGSIREIILPKGLDLDRPKRTRTSFTA 109

  Fly   134 LQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKK----------------- 181
            .||.:|...|||.||:...||.|||..|.|::||||:||||||:|.||                 
Mouse   110 EQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQGKDSELRSVVSETAA 174

  Fly   182 ------------------------------MMKAAQGP-------GTNSG--------------- 194
                                          :..|.:||       |..:|               
Mouse   175 TCSVLRLLEQGRLLSPPGLPALLPPCATGALGSALRGPSLPALGAGAAAGSAAAAAAAAAATAPG 239

  Fly   195 --------MPLGGGGPNPGQHSPNQMHSG--ELANGRFLWAALETNGTLALVHSTGGNNGGGSNS 249
                    .|..||.|.||...|..:|:|  ..::|.|........|::|...|:......||.:
Mouse   240 PAGAASQHQPAVGGAPGPGPAGPGGLHAGAPTASHGLFSLPVPSLLGSVASRLSSAPLTMAGSLA 304

  Fly   250 GS 251
            |:
Mouse   305 GN 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 29/55 (53%)
Vax1NP_033527.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 4/23 (17%)
Homeobox 103..156 CDD:306543 28/52 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..269 8/29 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..338
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.