DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and EMX1

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_004088.2 Gene:EMX1 / 2016 HGNCID:3340 Length:290 Species:Homo sapiens


Alignment Length:258 Identity:77/258 - (29%)
Similarity:106/258 - (41%) Gaps:84/258 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GGNT------------AASVTP----GINIP----GKSAFVE-LQQHAAAGYGGIRSTYQHFGPQ 58
            ||.|            |||..|    .:|.|    .::|||. ....||||.|  ||.|      
Human    56 GGGTGGGGAGSHLLAAAASEEPLRPTALNYPHPSAAEAAFVSGFPAAAAAGAG--RSLY------ 112

  Fly    59 GGQDSGFPS----------PRSALG-YPFPPMH------------------QNSYSGYHLGSYAP 94
            ||.:..||.          |...|| .|..|.|                  :|.:.|:.      
Human   113 GGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHFYPWVLRNRFFGHR------ 171

  Fly    95 PCASPPKDDFSISDKCEDSGLRVNGK-GKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELA 158
                     |..||..:| ||.::|. .:|.::.||.:|..||.:|.|.|::..|:...||.:||
Human   172 ---------FQASDVPQD-GLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLA 226

  Fly   159 ASLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTNSGMPLGGGGPNPGQHSPNQMH-SGELANG 220
            .||.|::||||:||||||:|||:.....:||.:..        ...|.|..|:.. :.:.|||
Human   227 GSLSLSETQVKVWFQNRRTKYKRQKLEEEGPESEQ--------KKKGSHHINRWRIATKQANG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 27/52 (52%)
EMX1NP_004088.2 COG5576 140..>251 CDD:227863 42/126 (33%)
Homeobox 196..248 CDD:278475 27/51 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..257 21/40 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.