Sequence 1: | NP_001137759.1 | Gene: | Dll / 37973 | FlyBaseID: | FBgn0000157 | Length: | 347 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004088.2 | Gene: | EMX1 / 2016 | HGNCID: | 3340 | Length: | 290 | Species: | Homo sapiens |
Alignment Length: | 258 | Identity: | 77/258 - (29%) |
---|---|---|---|
Similarity: | 106/258 - (41%) | Gaps: | 84/258 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 GGNT------------AASVTP----GINIP----GKSAFVE-LQQHAAAGYGGIRSTYQHFGPQ 58
Fly 59 GGQDSGFPS----------PRSALG-YPFPPMH------------------QNSYSGYHLGSYAP 94
Fly 95 PCASPPKDDFSISDKCEDSGLRVNGK-GKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELA 158
Fly 159 ASLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTNSGMPLGGGGPNPGQHSPNQMH-SGELANG 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dll | NP_001137759.1 | Homeobox | 127..180 | CDD:278475 | 27/52 (52%) |
EMX1 | NP_004088.2 | COG5576 | 140..>251 | CDD:227863 | 42/126 (33%) |
Homeobox | 196..248 | CDD:278475 | 27/51 (53%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 216..257 | 21/40 (53%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0850 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |