DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and Obox7

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001033765.1 Gene:Obox7 / 194588 MGIID:3646231 Length:218 Species:Mus musculus


Alignment Length:161 Identity:44/161 - (27%)
Similarity:70/161 - (43%) Gaps:20/161 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 RSALGYPFPPMHQNSYSGYHLGSYAPPCASPPKDDFSISDKC--EDSGLRVNGKGKKMRKPRTIY 131
            :|:|..|...:.|....|....|...|          :|||.  :.:||..:   :..||.|.:|
Mouse    50 QSSLSVPERNLLQQESEGPSRQSGCMP----------LSDKYVNKQTGLLAS---RNFRKERIVY 101

  Fly   132 SSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKM----MKAAQGPGTN 192
            |..|.:.|.:.|...||....:..|||..:|:|:.::|.||:|.|:||::|    :|.|......
Mouse   102 SKEQQRLLQKHFDECQYPKEKKIVELAVLIGVTKMEIKKWFKNNRAKYRQMNLQNIKQALPESNG 166

  Fly   193 SGMPLGGGGPNPGQHSPNQMHSGE-LANGRF 222
            |...:......||........:|| :.:|.|
Mouse   167 SSKAVSESTHFPGSIPVVASDNGESICSGTF 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 19/52 (37%)
Obox7NP_001033765.1 homeodomain 95..153 CDD:238039 22/57 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.