DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and vab-15

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_509648.1 Gene:vab-15 / 181197 WormBaseID:WBGene00006881 Length:225 Species:Caenorhabditis elegans


Alignment Length:222 Identity:80/222 - (36%)
Similarity:98/222 - (44%) Gaps:56/222 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DAP-DAPHTPKYMDGGNTAASVTPGINIPGKSAFVELQQHAAAGYGG--IRSTYQHFGPQGGQ-- 61
            |.| ..|.|||           ||.: |||        .|....|.|  :.....:|...|.:  
 Worm    30 DLPKPTPITPK-----------TPML-IPG--------LHPMTPYFGAQLDPVMIYFAQTGNRLP 74

  Fly    62 ----DSGFPSPRSALGYPFPPMHQNSYSGYHLGSYAPPCASPPKDDFSIS---DKCEDSGLRVNG 119
                ||   ||.|....|....|...:    |.|....  ||..||..|.   .||.   ||   
 Worm    75 IVSSDS---SPESCASSPLSMQHSLQW----LSSQRED--SPTSDDAKIQIGLSKCM---LR--- 124

  Fly   120 KGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMK 184
            |.|..|||||.:|:.||..|.|:||..|||::.||||.:|||.||:|||||||||||:|.|::.:
 Worm   125 KHKNNRKPRTPFSTQQLISLERKFQSKQYLSIAERAEFSASLQLTETQVKIWFQNRRAKSKRLQE 189

  Fly   185 A-------AQGPGTNSGMPLGGGGPNP 204
            |       ||.....:...  ||.|:|
 Worm   190 AEVEKVKFAQASAYAAAAV--GGAPDP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 34/52 (65%)
vab-15NP_509648.1 Homeobox 132..185 CDD:278475 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.