DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and ceh-51

DIOPT Version :10

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_507685.1 Gene:ceh-51 / 180233 WormBaseID:WBGene00013583 Length:234 Species:Caenorhabditis elegans


Alignment Length:132 Identity:31/132 - (23%)
Similarity:54/132 - (40%) Gaps:24/132 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 NHLDDVYLSKKVRNMFDFSFDLEAFAGQMEEQANPAF--KEYHGLLNITKI---------TPFNS 309
            ||||.:.|... |:....|.....|:|.....::..|  :|:...|:.:|:         ...|.
 Worm    91 NHLDGIQLFGP-RSDVSGSIMSNRFSGNKRSNSDSHFTTQEHPETLHWSKLLRNGPGSFSMNVNP 154

  Fly   310 LASYHPK----TRDLAFKLKRSKFVIEKLHLPPDI-----ADEDGASKSQVPA-MSCASVGGKSK 364
            ||:..|:    ...|..:|..|:|..|  ::.|.:     |||...:..:.|. :|..::...||
 Worm   155 LANQPPRGGGQISHLLHQLSTSRFKDE--NVGPSVIAQTAADEGSRTGMKGPGILSSFTMPNSSK 217

  Fly   365 LD 366
            |:
 Worm   218 LE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeodomain 125..181 CDD:459649
ceh-51NP_507685.1 Homeodomain 148..204 CDD:459649 13/57 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.