DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and Msx2

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_038629.2 Gene:Msx2 / 17702 MGIID:97169 Length:267 Species:Mus musculus


Alignment Length:172 Identity:67/172 - (38%)
Similarity:87/172 - (50%) Gaps:38/172 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GGQDSGFPSPRSALGYPFPP---MHQNSYSG----YHLGSYAPP--CASPPKDDFSISDKCEDSG 114
            |.:|:..|.|   |..||..   ..:||..|    ...|.|:||  ..||        ..|.   
Mouse    85 GVRDAHSPGP---LVKPFETASVKSENSEDGAPWIQEPGRYSPPPRHMSP--------TTCT--- 135

  Fly   115 LRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKY 179
            ||   |.|..|||||.:::.||..|.|:|::.|||::.||||.::||.||:|||||||||||:|.
Mouse   136 LR---KHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKA 197

  Fly   180 KKM-------MKAAQGPGTNSGMPLGGGGPNPGQHSPNQMHS 214
            |::       :|.|..|...||..|    |.| .:||.|..|
Mouse   198 KRLQEAELEKLKMAAKPMLPSGFSL----PFP-INSPLQAAS 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 31/52 (60%)
Msx2NP_038629.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..132 9/35 (26%)
Homeobox 145..198 CDD:306543 31/52 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.