DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and Msx1

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_034965.2 Gene:Msx1 / 17701 MGIID:97168 Length:303 Species:Mus musculus


Alignment Length:242 Identity:75/242 - (30%)
Similarity:100/242 - (41%) Gaps:74/242 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PGKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQDSGFPSPRSALGYPFPPMHQNSYSGYHLGS-- 91
            ||....|.:....|...||   :.||.|.:.|          :||.|..|........:.:|.  
Mouse    73 PGAKESVLVASEGAQAAGG---SVQHLGTRPG----------SLGAPDAPSSPRPLGHFSVGGLL 124

  Fly    92 --------------------------YAPPCA---SPPKDDFSISDKCEDSGLRVNGKGKKMRKP 127
                                      ::||.|   |||        .|.   ||   |.|..|||
Mouse   125 KLPEDALVKAESPEKLDRTPWMQSPRFSPPPARRLSPP--------ACT---LR---KHKTNRKP 175

  Fly   128 RTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKM-------MKA 185
            ||.:::.||..|.|:|::.|||::.||||.::||.||:|||||||||||:|.|::       :|.
Mouse   176 RTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKM 240

  Fly   186 AQGP-----GTNSGMPLGGGGPNPGQHSPNQMHSGELANGRFLWAAL 227
            |..|     ......||||    |...:.....|...|:|.|..|||
Mouse   241 AAKPMLPPAAFGLSFPLGG----PAAVAAAAGASLYSASGPFQRAAL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 31/52 (60%)
Msx1NP_034965.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..53
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..112 10/34 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 135..163 6/35 (17%)
Homeobox 175..228 CDD:278475 31/52 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.