Sequence 1: | NP_001137759.1 | Gene: | Dll / 37973 | FlyBaseID: | FBgn0000157 | Length: | 347 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034965.2 | Gene: | Msx1 / 17701 | MGIID: | 97168 | Length: | 303 | Species: | Mus musculus |
Alignment Length: | 242 | Identity: | 75/242 - (30%) |
---|---|---|---|
Similarity: | 100/242 - (41%) | Gaps: | 74/242 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 PGKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQDSGFPSPRSALGYPFPPMHQNSYSGYHLGS-- 91
Fly 92 --------------------------YAPPCA---SPPKDDFSISDKCEDSGLRVNGKGKKMRKP 127
Fly 128 RTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKM-------MKA 185
Fly 186 AQGP-----GTNSGMPLGGGGPNPGQHSPNQMHSGELANGRFLWAAL 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dll | NP_001137759.1 | Homeobox | 127..180 | CDD:278475 | 31/52 (60%) |
Msx1 | NP_034965.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 22..53 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 90..112 | 10/34 (29%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 135..163 | 6/35 (17%) | |||
Homeobox | 175..228 | CDD:278475 | 31/52 (60%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0850 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |