DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and pal-1

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001021209.1 Gene:pal-1 / 175638 WormBaseID:WBGene00003912 Length:270 Species:Caenorhabditis elegans


Alignment Length:157 Identity:43/157 - (27%)
Similarity:66/157 - (42%) Gaps:38/157 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 DSG-FPSPRSALGYPFPPMHQNSYSGYHLGSYAPPCA---------------------------- 97
            ||| :||| |.:..|||.....:.|...|.:.|...|                            
 Worm   108 DSGMYPSP-SDMMTPFPSTSSGAASSSELSAAAAAAANYQMRAATCYQQSVWPFMDYQQFQGFSW 171

  Fly    98 ------SPPKDDFSISD-KCEDSGLRVNG-KGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPER 154
                  :..||..|.|| |...:|...|. :.:...|.|.:||..|..:|.:.|..:.::....:
 Worm   172 KMPLGNNHGKDRRSSSDGKTLPTGPGTNNVRVRTADKYRMVYSDYQRLELEKEFHTSPFITSDRK 236

  Fly   155 AELAASLGLTQTQVKIWFQNRRSKYKK 181
            ::|:..|.||:.|:||||||||:|.::
 Worm   237 SQLSTMLSLTERQIKIWFQNRRAKDRR 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 20/52 (38%)
pal-1NP_001021209.1 Homeobox 210..262 CDD:278475 20/51 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.