DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and cog-1

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001022264.1 Gene:cog-1 / 175149 WormBaseID:WBGene00000584 Length:256 Species:Caenorhabditis elegans


Alignment Length:95 Identity:35/95 - (36%)
Similarity:57/95 - (60%) Gaps:4/95 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKY 179
            |..|....:.::.|..::..|:.||.|:|::|:|||..:||:||..|.::::|||:||||||:|:
 Worm   160 LSPNSLNMQKKQSRPTFTGHQIYQLERKFEQTKYLAGADRAQLAQELNMSESQVKVWFQNRRTKW 224

  Fly   180 KKMMKAAQGPGTNSGMPLGGGGPNPGQHSP 209
            :| .:||.......|   ..|..:|...||
 Worm   225 RK-KEAADNALVKRG---ASGDKSPCSLSP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 25/52 (48%)
cog-1NP_001022264.1 Homeobox 172..226 CDD:365835 25/53 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.