DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and DLX5

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_005212.1 Gene:DLX5 / 1749 HGNCID:2918 Length:289 Species:Homo sapiens


Alignment Length:289 Identity:104/289 - (35%)
Similarity:125/289 - (43%) Gaps:89/289 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 HFGPQGGQDSGFPSPRSAL--------------------GYPFPPMHQNSY-SGYHL--GSY--A 93
            ::.|.||...|:.||.||.                    .||.......|| |.||.  |:|  .
Human    47 YYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRV 111

  Fly    94 PPCASPPKDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELA 158
            |...:.|:.:.:     |.....||||.||:|||||||||.||..|.||||:|||||||||||||
Human   112 PSATNQPEKEVT-----EPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELA 171

  Fly   159 ASLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTNSGMPLGGGGPNPGQHSPNQMHSGELANGRFL 223
            ||||||||||||||||:|||.||:||               .|..|.:|||:.  |..:|     
Human   172 ASLGLTQTQVKIWFQNKRSKIKKIMK---------------NGEMPPEHSPSS--SDPMA----- 214

  Fly   224 WAALETNGTLALVHSTGGNNGGGSNS-GSPSHYLPPGHSPTPSSTPVSELSPEFPPTGLSPPTQA 287
                                   .|| .||:.:.|.|.|.:.|..|.:.     |||....|..:
Human   215 -----------------------CNSPQSPAVWEPQGSSRSLSHHPHAH-----PPTSNQSPASS 251

  Fly   288 PWDQKPHWI--------DHKPPPQMTPQP 308
            ..:....|.        .|.|||.....|
Human   252 YLENSASWYTSAASSINSHLPPPGSLQHP 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 46/52 (88%)
DLX5NP_005212.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 0/1 (0%)
DLL_N 32..118 CDD:315147 18/70 (26%)
Homeobox 140..193 CDD:306543 46/52 (88%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..251 20/87 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..289 5/11 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153141
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I4345
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416398at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40491
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X884
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.